Ensembl - PDFSEARCH.IO - Document Search Engine

Ensembl
Results: 146

#	Item
21	High-throughput annotation of genomic datasets with Genephony Angelo Nuzzo and Alberto Riva ! Abstract — We describe the initial implementation of Genephony, an online tool for the creation and manipulation of Add to Reading List Source URL: www.biotconf.org Language: English - Date: 2014-05-21 17:42:44 Biological databases Genomics Galaxy Single-nucleotide polymorphism Human genome Ensembl UCSC Genome Browser Biology Bioinformatics Science
22	Conditions Générales de Ventes 1-Définitions « Annonceur » : toute personne physique ou morale qui acquiert ou souhaite acquérir des Espaces Publicitaires à des fins publicitaires. « Conditions Titre » : ensembl Add to Reading List Source URL: www.trombinoscope.com - Date: 2014-11-20 12:32:40
23	Additional file 1: Protein sequences used in phylogenetic analysis. NCBI or Ensembl accession numbers follow genus numbers. FucD is fuconate dehydratase of Xanthomonas. >FucD PDB2HXT MRTIIALETHDVRFPTSRELDGSDAMNPDPDYSA Add to Reading List Source URL: www.cellandbioscience.com Language: English
24	AnimalQTLdb: A Livestock QTL Database Tool Set for Positional QTL Information Mining and Beyond Zhi-Liang Hu, Eric Ryan Fritz and James M. Reecy Department of Animal Science and Center for Integrated Animal Genomics, Iow Add to Reading List Source URL: www.animalgenome.org Language: English - Date: 2009-01-20 23:11:53 Statistical genetics Genomics Biological databases Genetic mapping Ensembl Human genome Single-nucleotide polymorphism DbSNP Genome Biology Genetics Bioinformatics
25	FishMap 2.0 MANUAL FishMap(Zv8) Genome Browser: General Help These are general instructions for using the Generic Genome Browser. This page should be customized by the administrator of this resource to describe site-sp Add to Reading List Source URL: genome.igib.res.in Language: English - Date: 2013-09-28 00:34:18 RNA Molecular genetics Biological databases Non-coding RNA Genome browser FGF-1 internal ribosome entry site Ensembl TrkB IRES Iron response element Genetics Biology Cis-regulatory RNA elements
26	PDF Document Add to Reading List Source URL: bioconductor.org Language: English - Date: 2015-05-28 21:21:35 Genomics Biological databases Gene expression UCSC Genome Browser RNA-Seq Genome browser Gene Expressed sequence tag Ensembl Biology Bioinformatics Genetics
27	PDF Document Add to Reading List Source URL: www.bioconductor.org Language: English - Date: 2015-04-16 22:07:29 Molecular biology Genetics Biological databases Inparanoid Speciation House mouse Homology Ensembl Arc Biology Bioinformatics Science
28	13742_2015_61_Article 1..4 Add to Reading List Source URL: www.gigasciencejournal.com Language: English Gene expression Genomics RNA Genome project RNA-Seq Human genome Ensembl Transcriptome Sequence assembly Biology Genetics Bioinformatics
29	LocusTrack: Integrated visualization of GWAS results and genomic annotation Add to Reading List Source URL: www.scfbm.org Language: English Biological databases Genomics Genetic epidemiology UCSC Genome Browser Genome browser Genome-wide association study Single-nucleotide polymorphism Ensembl International HapMap Project Bioinformatics Science Genetics
30	GenomicRanges HOWTOs Bioconductor Team Edited: July 2014; Compiled: April 22, 2015 Contents 1 Introduction Add to Reading List Source URL: bioconductor.org Language: English - Date: 2015-04-22 22:17:07 Bioinformatics Biological databases Genetics DNA sequencing Bioconductor Ensembl RNA-Seq UCSC Genome Browser Genome browser Biology Science Molecular biology

UPDATE