Xanthomonas - PDFSEARCH.IO - Document Search Engine

Xanthomonas
Results: 186

#	Item
21	Xanthomonas campestris pv. phaseoli Add to Reading List Source URL: www.eppo.int Language: English - Date: 2012-05-01 04:52:02
22	Additional file 1: Protein sequences used in phylogenetic analysis. NCBI or Ensembl accession numbers follow genus numbers. FucD is fuconate dehydratase of Xanthomonas. >FucD PDB2HXT MRTIIALETHDVRFPTSRELDGSDAMNPDPDYSA Add to Reading List Source URL: www.cellandbioscience.com Language: English
23	Angular leaf spot of strawberry, caused by Xanthomonas fragariae, can be suppressed by use of copper sprays (copper hydroxide or copper sulfate products). Copper hydroxide products may be more efficacious than copper Add to Reading List Source URL: www.smallfruits.org - Date: 2005-12-20 08:51:10
24	Disease Management in Leafy Greens Mohammad Babadoost University of Illinois Add to Reading List Source URL: jhawkins54.typepad.com Language: English - Date: 2015-03-20 09:46:23 Alternaria padwickii Fungicide use in the United States Alternaria Xanthomonas campestris pv. campestris Black rot
25	California Leafy Greens Research Program Spring Report April 1, 2010 to March 31, 2011 I. Abstract. Project Title: Development of Management Strategies for Bacterial Leaf Spot of Lettuce. Investigator: Carolee Bull, USDA Add to Reading List Source URL: calgreens.org Language: English - Date: 2011-08-25 09:54:07 Biological pest control Crops Disease resistance in fruit and vegetables Fruit Vegetables Xanthomonas campestris Land management Bacterial blight Xanthomonas oryzae pv. oryzae Xanthomonadales Agriculture Biology
26	Title: The effects of planting date, varietal susceptibility and residue management on severity of Fusarium wilt Funding period: Add to Reading List Source URL: calgreens.org Language: English - Date: 2015-03-19 12:48:04 Health Fusarium wilt Wheat diseases Xanthomonas campestris pv. campestris Fusarium Microbiology Biology
27	California Leafy Greens Research Program Spring Report April 1, 2011 to March 31, 2012 Project Title: Development of management strategies for Bacterial Leaf Spot of Lettuce. Principle investigator: Carolee Bull, USDA/AR Add to Reading List Source URL: calgreens.org Language: English - Date: 2012-10-14 19:05:57 Agriculture Xanthomonas campestris Multilocus sequence typing Disease resistance in fruit and vegetables Pathovar Biology Microbiology Xanthomonadales
28	CALIFORNIA LEAFY GREENS RESEARCH PROGRAM Annual Report April 1, 2009 to March 31, 2010 I. Abstract Project Title: Development of Management Strategies for Bacterial Leaf Spot and Corky Root of Lettuce. Add to Reading List Source URL: calgreens.org Language: English - Date: 2010-08-27 17:39:16 Health Biological pest control Crops Disease resistance in fruit and vegetables Fruit Vegetables Xanthomonas campestris Lettuce Elm Biology Agriculture Xanthomonadales
29	California Leafy Greens Research Program Final Report forProject Title: Development of management strategies for Bacterial Leaf Spot Add to Reading List Source URL: calgreens.org Language: English - Date: 2013-07-19 18:19:38 Agriculture Xanthomonas campestris Pathovar Disease resistance in fruit and vegetables Xanthomonas campestris pv. campestris Microbiology Biology Xanthomonadales
30	California Leafy Greens Research Program Spring Report 2015 April 1, 2014 to March 31, 2015 Project Title: Development of management strategies for Bacterial Leaf Spot of Lettuce. Principle investigator: Carolee Bull, US Add to Reading List Source URL: calgreens.org Language: English - Date: 2015-03-19 12:47:45 Microbiology Xanthomonas campestris Genomics Gene Biology Molecular biology Xanthomonadales

UPDATE